Lineage for d1bvuf2 (1bvu F:3-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890363Species Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)
  8. 2890369Domain d1bvuf2: 1bvu F:3-180 [33879]
    Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvuf2

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis
PDB Compounds: (F:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1bvuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvuf2 c.58.1.1 (F:3-180) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

SCOPe Domain Coordinates for d1bvuf2:

Click to download the PDB-style file with coordinates for d1bvuf2.
(The format of our PDB-style files is described here.)

Timeline for d1bvuf2: