SCOPe 2.08: Domain d1bvue2: 1bvu E:3-180

Lineage for d1bvue2 (1bvu E:3-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)

8. Domain d1bvue2: 1bvu E:3-180 [33878]
   Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvue2

PDB Entry: 1bvu, 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

PDB Compounds: (E:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1bvue2:

Sequence; same for both SEQRES and ATOM records:

>d1bvue2 c.58.1.1 (E:3-180) Glutamate dehydrogenase {Thermococcus litoralis [TaxId: 2265]}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

Timeline for d1bvue2:

• d1bvue2 first appeared (with stable ids) in SCOP 1.55
  
• d1bvue2 appears in SCOPe 2.07