Lineage for d5vzrl1 (5vzr L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744266Domain d5vzrl1: 5vzr L:1-107 [338766]
    Other proteins in same PDB: d5vzra_, d5vzrb2, d5vzrh_, d5vzrl2
    automated match to d1h0da1
    complexed with gol

Details for d5vzrl1

PDB Entry: 5vzr (more details), 1.57 Å

PDB Description: crystal structure of mers-cov neutralizing antibody g4 fab
PDB Compounds: (L:) G4 antibody light chain

SCOPe Domain Sequences for d5vzrl1:

Sequence, based on SEQRES records: (download)

>d5vzrl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatsnqgs
gvparfigsgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d5vzrl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatarfig
sgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik

SCOPe Domain Coordinates for d5vzrl1:

Click to download the PDB-style file with coordinates for d5vzrl1.
(The format of our PDB-style files is described here.)

Timeline for d5vzrl1: