Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d5vzrl1: 5vzr L:1-107 [338766] Other proteins in same PDB: d5vzra_, d5vzrb2, d5vzrh_, d5vzrl2 automated match to d1h0da1 complexed with gol |
PDB Entry: 5vzr (more details), 1.57 Å
SCOPe Domain Sequences for d5vzrl1:
Sequence, based on SEQRES records: (download)
>d5vzrl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatsnqgs gvparfigsgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik
>d5vzrl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaslavslgqratiscrasesvdnygisfmnwfqqkpgqppkllisatarfig sgsgtdfslnihpveeddtamyfcqqskevprtfgggtkleik
Timeline for d5vzrl1:
View in 3D Domains from other chains: (mouse over for more information) d5vzra_, d5vzrb1, d5vzrb2, d5vzrh_ |