SCOP 1.69: Domain d1bvuc2: 1bvu C:3-180

Lineage for d1bvuc2 (1bvu C:3-180)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
Protein Glutamate dehydrogenase [53225] (7 species)
Species Archaeon Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)
Domain d1bvuc2: 1bvu C:3-180 [33876]
Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvuc2

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvuc2 c.58.1.1 (C:3-180) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

SCOP Domain Coordinates for d1bvuc2:

Click to download the PDB-style file with coordinates for d1bvuc2.
(The format of our PDB-style files is described here.)

Timeline for d1bvuc2: