Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein Ornithine aminotransferase [53422] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [53423] (7 PDB entries) |
Domain d5vwob_: 5vwo B: [338753] automated match to d2byja1 complexed with 9qj |
PDB Entry: 5vwo (more details), 1.77 Å
SCOPe Domain Sequences for d5vwob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vwob_ c.67.1.4 (B:) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssysavnqghchp kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl rlrdngllakpthgdiirfapplvikedelresieiinktilsf
Timeline for d5vwob_: