Lineage for d5vwob_ (5vwo B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147847Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2148001Protein Ornithine aminotransferase [53422] (3 species)
  7. 2148002Species Human (Homo sapiens) [TaxId:9606] [53423] (7 PDB entries)
  8. 2148010Domain d5vwob_: 5vwo B: [338753]
    automated match to d2byja1
    complexed with 9qj

Details for d5vwob_

PDB Entry: 5vwo (more details), 1.77 Å

PDB Description: ornithine aminotransferase inactivated by (1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp)
PDB Compounds: (B:) Ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d5vwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vwob_ c.67.1.4 (B:) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssysavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d5vwob_:

Click to download the PDB-style file with coordinates for d5vwob_.
(The format of our PDB-style files is described here.)

Timeline for d5vwob_: