SCOP 1.59: Domain d1bvua2: 1bvu A:3-180

Lineage for d1bvua2 (1bvu A:3-180)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (6 species)
Species Archaeon Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)
Domain d1bvua2: 1bvu A:3-180 [33874]
Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvua2

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvua2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

SCOP Domain Coordinates for d1bvua2:

Click to download the PDB-style file with coordinates for d1bvua2.
(The format of our PDB-style files is described here.)

Timeline for d1bvua2: