SCOPe 2.08: Domain d5vb0h1: 5vb0 H:1-138

Lineage for d5vb0h1 (5vb0 H:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [338723] (1 PDB entry)

8. Domain d5vb0h1: 5vb0 H:1-138 [338734]
   Other proteins in same PDB: d5vb0a2, d5vb0c2, d5vb0f2, d5vb0h2
   automated match to d4jh2a_
   complexed with mn, ni

Details for d5vb0h1

PDB Entry: 5vb0, 2.69 Å

PDB Description: crystal structure of fosfomycin resistance protein fosa3

PDB Compounds: (H:) Fosfomycin resistance protein FosA3

SCOPe Domain Sequences for d5vb0h1:

Sequence, based on SEQRES records:

>d5vb0h1 d.32.1.0 (H:1-138) automated matches {Escherichia coli [TaxId: 562]}
mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp
qesdythyafsvaeeefagvvallaqagaevwkdnrsegasyyfldpdghklelhvgnla
qrlaacrerpykgmvffd

Sequence, based on observed residues (ATOM records):

>d5vb0h1 d.32.1.0 (H:1-138) automated matches {Escherichia coli [TaxId: 562]}
mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp
qesdythyafsvaeeefagvvallaqagaevwkdngasyyfldpdghklelhvgnlaqrl
aacrerpykgmvffd

Timeline for d5vb0h1:

• d5vb0h1 first appeared in SCOPe 2.06
  
• d5vb0h1 appears in SCOPe 2.07