Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Escherichia coli [TaxId:562] [338723] (1 PDB entry) |
Domain d5vb0h1: 5vb0 H:1-138 [338734] Other proteins in same PDB: d5vb0a2, d5vb0c2, d5vb0f2, d5vb0h2 automated match to d4jh2a_ complexed with mn, ni |
PDB Entry: 5vb0 (more details), 2.69 Å
SCOPe Domain Sequences for d5vb0h1:
Sequence, based on SEQRES records: (download)
>d5vb0h1 d.32.1.0 (H:1-138) automated matches {Escherichia coli [TaxId: 562]} mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp qesdythyafsvaeeefagvvallaqagaevwkdnrsegasyyfldpdghklelhvgnla qrlaacrerpykgmvffd
>d5vb0h1 d.32.1.0 (H:1-138) automated matches {Escherichia coli [TaxId: 562]} mlqglnhltlavsdlasslafyqqlpgmrlhaswdsgaylscgalwlclsldeqrrktpp qesdythyafsvaeeefagvvallaqagaevwkdngasyyfldpdghklelhvgnlaqrl aacrerpykgmvffd
Timeline for d5vb0h1: