| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein automated matches [191000] (6 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (15 PDB entries) |
| Domain d5v2cf_: 5v2c F: [338733] Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_ automated match to d2axtf1 complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd |
PDB Entry: 5v2c (more details), 1.9 Å
SCOPe Domain Sequences for d5v2cf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v2cf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d5v2cf_: