Lineage for d5v2cf_ (5v2c F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632073Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2632074Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2632127Protein automated matches [191000] (6 species)
    not a true protein
  7. 2632152Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (15 PDB entries)
  8. 2632158Domain d5v2cf_: 5v2c F: [338733]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2ck_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d2axtf1
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2cf_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5v2cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2cf_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5v2cf_:

Click to download the PDB-style file with coordinates for d5v2cf_.
(The format of our PDB-style files is described here.)

Timeline for d5v2cf_: