Lineage for d5v2ck_ (5v2c K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631976Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2631977Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 2631978Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2631985Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (25 PDB entries)
  8. 2631992Domain d5v2ck_: 5v2c K: [338710]
    Other proteins in same PDB: d5v2ca_, d5v2cb_, d5v2cc_, d5v2cd_, d5v2ce_, d5v2cf_, d5v2ch_, d5v2ci_, d5v2cj_, d5v2cl_, d5v2cm_, d5v2co1, d5v2co2, d5v2ct_, d5v2cu_, d5v2cv_, d5v2cx_, d5v2cz_
    automated match to d2axtk1
    complexed with 1pe, 2pe, bcr, bct, ca, cl, cla, dgd, edo, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, p6g, pg4, pge, pho, pl9, sqd

Details for d5v2ck_

PDB Entry: 5v2c (more details), 1.9 Å

PDB Description: re-refinement of crystal structure of photosystem ii complex
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5v2ck_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2ck_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5v2ck_:

Click to download the PDB-style file with coordinates for d5v2ck_.
(The format of our PDB-style files is described here.)

Timeline for d5v2ck_: