SCOP 1.69: Domain d1gtma2: 1gtm A:3-180

Lineage for d1gtma2 (1gtm A:3-180)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (7 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry)

8. Domain d1gtma2: 1gtm A:3-180 [33871]
   Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1

Details for d1gtma2

PDB Entry: 1gtm, 2.2 Å

PDB Description: structure of glutamate dehydrogenase

SCOP Domain Sequences for d1gtma2:

Sequence; same for both SEQRES and ATOM records:

>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus}
adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi

Timeline for d1gtma2:

• d1gtma2 first appeared (with stable ids) in SCOP 1.55
  
• d1gtma2 appears in SCOP 1.67
  
• d1gtma2 appears in SCOP 1.71
  
• d1gtma2 appears in the current release, SCOPe 2.08