Lineage for d1gtma2 (1gtm A:3-180)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182880Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 182881Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 182882Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 182883Protein Glutamate dehydrogenase [53225] (7 species)
  7. 182884Species Archaeon Pyrococcus furiosus [TaxId:2261] [53227] (1 PDB entry)
  8. 182885Domain d1gtma2: 1gtm A:3-180 [33871]
    Other proteins in same PDB: d1gtma1, d1gtmb1, d1gtmc1

Details for d1gtma2

PDB Entry: 1gtm (more details), 2.2 Å

PDB Description: structure of glutamate dehydrogenase

SCOP Domain Sequences for d1gtma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus}
adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi

SCOP Domain Coordinates for d1gtma2:

Click to download the PDB-style file with coordinates for d1gtma2.
(The format of our PDB-style files is described here.)

Timeline for d1gtma2: