Lineage for d1aup_2 (1aup 1-192)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) 
Protein Glutamate dehydrogenase [53225] (7 species) Species Clostridium symbiosum [TaxId:1512] [53226] (4 PDB entries) 
Domain d1aup_2: 1aup 1-192 [33870]
Other proteins in same PDB: d1aup_1
Details for d1aup_2
PDB Entry: 1aup (more details), 2.5 Å
PDB Description: glutamate dehydrogenase
SCOP Domain Sequences for d1aup_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aup_2 c.58.1.1 (1-192) Glutamate dehydrogenase {Clostridium symbiosum}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpylgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvl
SCOP Domain Coordinates for d1aup_2:
Click to download the PDB-style file with coordinates for d1aup_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aup_2:
- d1aup_2 first appeared (with stable ids) in SCOP 1.55
- d1aup_2 appears in SCOP 1.59
- d1aup_2 appears in SCOP 1.63
- d1aup_2 appears in the current release, SCOPe 2.08, called d1aupa2
View in 3D
