![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) ![]() |
![]() | Family c.97.3.0: automated matches [267623] (1 protein) not a true family |
![]() | Protein automated matches [267670] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries) |
![]() | Domain d5u4pa_: 5u4p A: [338696] Other proteins in same PDB: d5u4pc_ automated match to d2o95a_ complexed with zn |
PDB Entry: 5u4p (more details), 2.5 Å
SCOPe Domain Sequences for d5u4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4pa_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeede knsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpll livdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrd
Timeline for d5u4pa_: