SCOPe 2.06: Domain d5u4pa_: 5u4p A:

Lineage for d5u4pa_ (5u4p A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.0: automated matches [267623] (1 protein)
   not a true family

6. Protein automated matches [267670] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries)

8. Domain d5u4pa_: 5u4p A: [338696]
   Other proteins in same PDB: d5u4pc_
   automated match to d2o95a_
   complexed with zn

Details for d5u4pa_

PDB Entry: 5u4p, 2.5 Å

PDB Description: protein-protein complex between 26s proteasome regulatory subunit rpn8, rpn11, and ubiquitin s31

PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d5u4pa_:

Sequence; same for both SEQRES and ATOM records:

>d5u4pa_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeede
knsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpll
livdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrd

Timeline for d5u4pa_:

• d5u4pa_ appears in periodic updates to SCOPe 2.06 starting on 2017-09-08
  
• d5u4pa_ appears in the current release, SCOPe 2.07