Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
Protein Proteasome regulatory subunit Rpn8 [346089] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries) |
Domain d5u4pa_: 5u4p A: [338696] Other proteins in same PDB: d5u4pb_, d5u4pc_ automated match to d2o95a_ complexed with zn |
PDB Entry: 5u4p (more details), 2.5 Å
SCOPe Domain Sequences for d5u4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4pa_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeede knsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpll livdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrd
Timeline for d5u4pa_: