Lineage for d5szwa1 (5szw A:3-101)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195774Domain d5szwa1: 5szw A:3-101 [338680]
    Other proteins in same PDB: d5szwa2
    automated match to d3hi9d_

Details for d5szwa1

PDB Entry: 5szw (more details)

PDB Description: nmr solution structure of the rrm1 domain of the post-transcriptional regulator hur
PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d5szwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szwa1 d.58.7.0 (A:3-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msngyedhmaedcrgdigrtnlivnylpqnmtqdelrslfssigevesaklirdkvaghs
lgygfvnyvtakdaeraintlnglrlqsktikvsyarps

SCOPe Domain Coordinates for d5szwa1:

Click to download the PDB-style file with coordinates for d5szwa1.
(The format of our PDB-style files is described here.)

Timeline for d5szwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5szwa2