Lineage for d1hrda2 (1hrd A:1-194)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25654Protein Glutamate dehydrogenase [53225] (5 species)
  7. 25655Species Clostridium symbiosum [TaxId:1512] [53226] (4 PDB entries)
  8. 25658Domain d1hrda2: 1hrd A:1-194 [33867]
    Other proteins in same PDB: d1hrda1, d1hrdb1, d1hrdc1

Details for d1hrda2

PDB Entry: 1hrd (more details), 1.96 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (A:)

SCOP Domain Sequences for d1hrda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrda2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvltg

SCOP Domain Coordinates for d1hrda2:

Click to download the PDB-style file with coordinates for d1hrda2.
(The format of our PDB-style files is described here.)

Timeline for d1hrda2: