Lineage for d5u4pc_ (5u4p C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177487Protein Ubiquitin [54238] (8 species)
  7. 2177490Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (13 PDB entries)
  8. 2177496Domain d5u4pc_: 5u4p C: [338669]
    Other proteins in same PDB: d5u4pa_
    automated match to d1otrb_
    complexed with zn

Details for d5u4pc_

PDB Entry: 5u4p (more details), 2.5 Å

PDB Description: protein-protein complex between 26s proteasome regulatory subunit rpn8, rpn11, and ubiquitin s31
PDB Compounds: (C:) Ubiquitin-40S ribosomal protein S31

SCOPe Domain Sequences for d5u4pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4pc_ d.15.1.1 (C:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5u4pc_:

Click to download the PDB-style file with coordinates for d5u4pc_.
(The format of our PDB-style files is described here.)

Timeline for d5u4pc_: