SCOPe 2.08: Domain d5t5vb1: 5t5v B:5-149

Lineage for d5t5vb1 (5t5v B:5-149)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)

8. Domain d5t5vb1: 5t5v B:5-149 [338664]
   Other proteins in same PDB: d5t5va2, d5t5vb2
   automated match to d1ygea2
   complexed with fe

Details for d5t5vb1

PDB Entry: 5t5v, 1.8 Å

PDB Description: lipoxygenase-1 (soybean) at 293k

PDB Compounds: (B:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d5t5vb1:

Sequence, based on SEQRES records:

>d5t5vb1 b.12.1.1 (B:5-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
ghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfl
egintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtir
fvcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d5t5vb1 b.12.1.1 (B:5-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
ghkikgtvvlmpknelevnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp
tlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvy
ntklyksvriffanhty

Timeline for d5t5vb1:

• d5t5vb1 first appeared in SCOPe 2.06
  
• d5t5vb1 appears in SCOPe 2.07