Lineage for d1bgva2 (1bgv A:1-194)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317636Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 317637Protein Glutamate dehydrogenase [53225] (7 species)
  7. 317656Species Clostridium symbiosum [TaxId:1512] [53226] (4 PDB entries)
  8. 317657Domain d1bgva2: 1bgv A:1-194 [33865]
    Other proteins in same PDB: d1bgva1

Details for d1bgva2

PDB Entry: 1bgv (more details), 1.9 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (A:)

SCOP Domain Sequences for d1bgva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvltg

SCOP Domain Coordinates for d1bgva2:

Click to download the PDB-style file with coordinates for d1bgva2.
(The format of our PDB-style files is described here.)

Timeline for d1bgva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bgva1