SCOPe 2.08: Domain d5t9ia_: 5t9i A:

Lineage for d5t9ia_ (5t9i A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Thermolysin [63414] (3 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
   Uniprot P00800

8. Domain d5t9ia_: 5t9i A: [338649]
   automated match to d1kkka_
   complexed with ca, lys, val, zn

Details for d5t9ia_

PDB Entry: 5t9i, 2.09 Å

PDB Description: conformational sampling differences across the arrhenius plot biphasic break point at ambient temperature in the enzyme thermolysin

PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5t9ia_:

Sequence; same for both SEQRES and ATOM records:

>d5t9ia_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

Timeline for d5t9ia_:

• d5t9ia_ first appeared in SCOPe 2.06
  
• d5t9ia_ appears in SCOPe 2.07