![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5o4eb2: 5o4e B:340-446 [338644] Other proteins in same PDB: d5o4ea1, d5o4ea2, d5o4eb1, d5o4ec1, d5o4ec2, d5o4ed1, d5o4ee_, d5o4ef_ automated match to d1hzhh4 complexed with cac, mpd, mrd, trs |
PDB Entry: 5o4e (more details), 2.15 Å
SCOPe Domain Sequences for d5o4eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o4eb2 b.1.1.0 (B:340-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} kgqprepqvyvyppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnyktt ppvldsdgsfalvskltvpypswlmgtrfscsvmhealhnhytqkhleyqwp
Timeline for d5o4eb2: