Lineage for d5p95a_ (5p95 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2468840Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2468851Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2468864Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (86 PDB entries)
  8. 2468891Domain d5p95a_: 5p95 A: [338628]
    automated match to d1h1da_
    complexed with 77g, cl, d1d, mg, nhe, po4

Details for d5p95a_

PDB Entry: 5p95 (more details), 1.3 Å

PDB Description: rat catechol o-methyltransferase in complex with n-[5-(6-aminopurin-9- yl)pentyl]-5-(4-fluorophenyl)-2,3-dihydroxybenzamide at 1.30a
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5p95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p95a_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5p95a_:

Click to download the PDB-style file with coordinates for d5p95a_.
(The format of our PDB-style files is described here.)

Timeline for d5p95a_: