Lineage for d5odhf_ (5odh F:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018909Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 3018910Protein automated matches [191173] (18 species)
    not a true protein
  7. 3019004Species Methanothermococcus thermolithotrophicus [TaxId:523845] [338595] (5 PDB entries)
  8. 3019009Domain d5odhf_: 5odh F: [338619]
    automated match to d3ze7b_
    complexed with 9s8, act, com, fad, fe, fes, gol, nfu, pe3, sf4, tp7, trs

Details for d5odhf_

PDB Entry: 5odh (more details), 2.2 Å

PDB Description: heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes
PDB Compounds: (F:) Methyl-viologen reducing hydrogenase, subunit A

SCOPe Domain Sequences for d5odhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5odhf_ e.18.1.0 (F:) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
vklsvepvtrveghgkisvsfddsgnldkvrfhvvevrgfekflegryvedapiytpric
gicqvahhlasakavdnvfgvkipetaellrnlmhqgatvhshalhfymlaapdlmfptt
ddvlkrnlmgiakehpeiikdaielrkagqnvvrvvggraihpvtavvggqskslkeeer
dellklsertielseksievgkkllenikdedlldigyfesahmgmvnngvhdlydgklr
vvnsegkveyefdpseymnyiaegvkpysylkfpylkdkgeedgiyrvntlsrlnvsdkm
atplaqkyydefvkefgkpchhpmlfhyarliellssaemvkellendkivgediraepe
evvgdgvgcveaprgtlihhfktdddgiitdtnlvvatvqnnpamdigvrkvaekyikap
edatpqvlnymemliraydpclscath

SCOPe Domain Coordinates for d5odhf_:

Click to download the PDB-style file with coordinates for d5odhf_.
(The format of our PDB-style files is described here.)

Timeline for d5odhf_: