Lineage for d5o4ee_ (5o4e E:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260392Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2260404Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2260407Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
    Uniprot P15692 40-133
  8. 2260434Domain d5o4ee_: 5o4e E: [338614]
    Other proteins in same PDB: d5o4ea1, d5o4ea2, d5o4eb1, d5o4eb2, d5o4ec1, d5o4ed1, d5o4ed2
    automated match to d4zffd_
    complexed with bma, cac, fuc, man, mpd, mrd, nag, trs

Details for d5o4ee_

PDB Entry: 5o4e (more details), 2.15 Å

PDB Description: crystal structure of vegf in complex with heterodimeric fcab janusct6
PDB Compounds: (E:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d5o4ee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4ee_ g.17.1.1 (E:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d5o4ee_:

Click to download the PDB-style file with coordinates for d5o4ee_.
(The format of our PDB-style files is described here.)

Timeline for d5o4ee_: