Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Psychrobacter arcticus [TaxId:259536] [338566] (12 PDB entries) |
Domain d5m8hg_: 5m8h G: [338574] automated match to d1usyh_ complexed with cl, mpd, sr |
PDB Entry: 5m8h (more details), 2.34 Å
SCOPe Domain Sequences for d5m8hg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m8hg_ c.94.1.0 (G:) automated matches {Psychrobacter arcticus [TaxId: 259536]} flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss rlivnqvsykrkfallepildsfknsi
Timeline for d5m8hg_: