Lineage for d1cx8e3 (1cx8 E:122-189,E:383-608)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398533Family c.56.5.5: Transferrin receptor ectodomain, protease-like domain [53210] (1 protein)
  6. 398534Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)
  7. 398535Species Human (Homo sapiens) [TaxId:9606] [53212] (2 PDB entries)
  8. 398543Domain d1cx8e3: 1cx8 E:122-189,E:383-608 [33855]
    Other proteins in same PDB: d1cx8a1, d1cx8a2, d1cx8b1, d1cx8b2, d1cx8c1, d1cx8c2, d1cx8d1, d1cx8d2, d1cx8e1, d1cx8e2, d1cx8f1, d1cx8f2, d1cx8g1, d1cx8g2, d1cx8h1, d1cx8h2

Details for d1cx8e3

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor

SCOP Domain Sequences for d1cx8e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8e3 c.56.5.5 (E:122-189,E:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens)}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

SCOP Domain Coordinates for d1cx8e3:

Click to download the PDB-style file with coordinates for d1cx8e3.
(The format of our PDB-style files is described here.)

Timeline for d1cx8e3: