Lineage for d1cx8d3 (1cx8 D:122-189,D:383-608)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142656Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 2142686Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)
  7. 2142687Species Human (Homo sapiens) [TaxId:9606] [53212] (4 PDB entries)
  8. 2142695Domain d1cx8d3: 1cx8 D:122-189,D:383-608 [33854]
    Other proteins in same PDB: d1cx8a1, d1cx8a2, d1cx8b1, d1cx8b2, d1cx8c1, d1cx8c2, d1cx8d1, d1cx8d2, d1cx8e1, d1cx8e2, d1cx8f1, d1cx8f2, d1cx8g1, d1cx8g2, d1cx8h1, d1cx8h2
    complexed with nag, sm

Details for d1cx8d3

PDB Entry: 1cx8 (more details), 3.2 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor
PDB Compounds: (D:) transferrin receptor protein

SCOPe Domain Sequences for d1cx8d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx8d3 c.56.5.5 (D:122-189,D:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

SCOPe Domain Coordinates for d1cx8d3:

Click to download the PDB-style file with coordinates for d1cx8d3.
(The format of our PDB-style files is described here.)

Timeline for d1cx8d3: