Class b: All beta proteins [48724] (177 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor (TNF) [49848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49849] (19 PDB entries) |
Domain d5m2ic_: 5m2i C: [338538] Other proteins in same PDB: d5m2ig_, d5m2ih_, d5m2ii_, d5m2ij_, d5m2ik_, d5m2il_ automated match to d1a8ma_ |
PDB Entry: 5m2i (more details), 2.15 Å
SCOPe Domain Sequences for d5m2ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2ic_ b.22.1.1 (C:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} dkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqgc psthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlekg drlsaeinrpdyldfaesgqvyfgiial
Timeline for d5m2ic_: