Lineage for d5k65a2 (5k65 A:340-445)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1361 PDB entries)
  8. 2356774Domain d5k65a2: 5k65 A:340-445 [338517]
    Other proteins in same PDB: d5k65a1, d5k65b1
    automated match to d1hzhh4
    complexed with bma, fuc, man, nag

Details for d5k65a2

PDB Entry: 5k65 (more details), 2.5 Å

PDB Description: crystal structure of vegf binding igg1-fc (fcab ct6)
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5k65a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k65a2 b.1.1.0 (A:340-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnyktt
ppvldsdgsfflyskltvpypswlmgtrfscsvmhealhnhytqkhleyqw

SCOPe Domain Coordinates for d5k65a2:

Click to download the PDB-style file with coordinates for d5k65a2.
(The format of our PDB-style files is described here.)

Timeline for d5k65a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5k65a1