Lineage for d5h4cc_ (5h4c C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777689Species Norway rat (Rattus norvegicus) [TaxId:10116] [320477] (4 PDB entries)
  8. 2777694Domain d5h4cc_: 5h4c C: [338495]
    automated match to d4qpya_
    complexed with nag

Details for d5h4cc_

PDB Entry: 5h4c (more details), 2.3 Å

PDB Description: crystal structure of cbln4
PDB Compounds: (C:) Protein Cbln4

SCOPe Domain Sequences for d5h4cc_:

Sequence, based on SEQRES records: (download)

>d5h4cc_ b.22.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anskvafsavrstnhepsemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhv
ikvyqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllg
gwqystfsgflvfpl

Sequence, based on observed residues (ATOM records): (download)

>d5h4cc_ b.22.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anskvafsavrstnhemsnktriiyfdqilvnvgnfftlesvfvaprkgiysfsfhvikv
yqsqtiqvnlmlngkpvisafagdkdvtreaatngvllyldkedkvylklekgnllggwq
ystfsgflvfpl

SCOPe Domain Coordinates for d5h4cc_:

Click to download the PDB-style file with coordinates for d5h4cc_.
(The format of our PDB-style files is described here.)

Timeline for d5h4cc_: