| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
| Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
| Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
| Species Thermosynechococcus elongatus [TaxId:197221] [338493] (1 PDB entry) |
| Domain d5h2ft_: 5h2f T: [338494] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_ automated match to d3a0ht_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2ft_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2ft_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 197221]}
metityvfifaciialfffaiffrepprit
Timeline for d5h2ft_: