Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.5: PsbZ-like [161055] (2 families) automatically mapped to Pfam PF01737 |
Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161058] (9 PDB entries) Uniprot Q8DHJ2 1-62 |
Domain d5h2fz_: 5h2f Z: [338490] Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_ automated match to d2axtz1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant |
PDB Entry: 5h2f (more details), 2.2 Å
SCOPe Domain Sequences for d5h2fz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h2fz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d5h2fz_: