Lineage for d5h2ff_ (5h2f F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026808Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)
  8. 3026810Domain d5h2ff_: 5h2f F: [338488]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fu_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d4ub8f_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2ff_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5h2ff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2ff_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5h2ff_:

Click to download the PDB-style file with coordinates for d5h2ff_.
(The format of our PDB-style files is described here.)

Timeline for d5h2ff_: