SCOPe 2.08: Domain d5gscb_: 5gsc B:

Lineage for d5gscb_ (5gsc B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Enterobacter aerogenes [TaxId:548] [188190] (5 PDB entries)

8. Domain d5gscb_: 5gsc B: [338479]
   automated match to d4wz4a_
   complexed with cd

Details for d5gscb_

PDB Entry: 5gsc, 1.95 Å

PDB Description: crystal structure of a class c beta lactamase of apo form

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5gscb_:

Sequence; same for both SEQRES and ATOM records:

>d5gscb_ e.3.1.0 (B:) automated matches {Enterobacter aerogenes [TaxId: 548]}
dplrpvvdasiqpllkehripgmavavlkdgkahyfnygvanresgagvseqtlfeigsv
sktltatlgayavvkgamqlddkasrhapwlkgsafdsitmgelatysagglplqfpeev
dssekmrayyrqwapvyspgshrqysnpsiglfghlaasslkqpfaplmeqtllpglgmh
htyvnvpkqamasyaygyskedkpirvnpgmladeaygiktssadllrfvkaniggvddk
alqqaislthqghysvggmtqglgwesyaypvteqtllagnsakvileanptaapresgs
qvlfnktgstngfgayvafvpargigivmlanrnypiearikaahailaqlag

Timeline for d5gscb_:

• d5gscb_ first appeared in SCOPe 2.06
  
• d5gscb_ appears in SCOPe 2.07