Lineage for d1cg2d1 (1cg2 D:26-213,D:327-414)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25605Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins)
  6. 25616Protein Carboxypeptidase G2, catalytic domain [53208] (1 species)
  7. 25617Species Pseudomonas sp., strain rs-16 [TaxId:306] [53209] (1 PDB entry)
  8. 25621Domain d1cg2d1: 1cg2 D:26-213,D:327-414 [33847]
    Other proteins in same PDB: d1cg2a2, d1cg2b2, d1cg2c2, d1cg2d2

Details for d1cg2d1

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

SCOP Domain Sequences for d1cg2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2d1 c.56.5.4 (D:26-213,D:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16}
qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
deklslgtXfnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpviesl
glpgfgyhsdkaeyvdisaiprrlymaarlimdlgag

SCOP Domain Coordinates for d1cg2d1:

Click to download the PDB-style file with coordinates for d1cg2d1.
(The format of our PDB-style files is described here.)

Timeline for d1cg2d1: