SCOPe 2.08: Domain d6aqga2: 6aqg A:154-495

Lineage for d6aqga2 (6aqg A:154-495)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Mycobacterium ulcerans [TaxId:362242] [334394] (2 PDB entries)

8. Domain d6aqga2: 6aqg A:154-495 [338468]
   Other proteins in same PDB: d6aqga1, d6aqgb1, d6aqgc1, d6aqgd1
   automated match to d3bjua2
   protein/RNA complex; complexed with krs, lys, mpd

Details for d6aqga2

PDB Entry: 6aqg, 2.25 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium ulcerans complexed with l-lysine and cladosporin

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqga2:

Sequence; same for both SEQRES and ATOM records:

>d6aqga2 d.104.1.0 (A:154-495) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
seesrvrqryvdlivrpqarevarqriaviravrnalerrgflevetpmlqtlaggaaar
pfvthsnaldidlylriapelflkrcivggfdrvfelnrvfrnegsdsthspefsmlety
qtygtyddsalitreliqevadeaigtrqlsmpdgsvydidgewatmemysslsealgeq
itpettvarlrdiasgldveidnsvfghgklveelwehavgnkltaptfvkdfpvettpl
trqhrsipgvtekwdlyvrgvelatgyselndpvvqrdrfadqaraaaagddeamqlded
fltaleygmppctgtgmgidrllmcltglsiretvlfpivrp

Timeline for d6aqga2:

• d6aqga2 first appeared in SCOPe 2.06
  
• d6aqga2 appears in SCOPe 2.07