Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Naegleria fowleri [TaxId:5763] [338422] (2 PDB entries) |
Domain d6aqze_: 6aqz E: [338466] Other proteins in same PDB: d6aqza2, d6aqzc2, d6aqzd2 automated match to d4e5ya_ complexed with edo, nap |
PDB Entry: 6aqz (more details), 2.4 Å
SCOPe Domain Sequences for d6aqze_:
Sequence, based on SEQRES records: (download)
>d6aqze_ c.2.1.0 (E:) automated matches {Naegleria fowleri [TaxId: 5763]} evsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadackqp fekyrptyvihlaafvgglfknmnfkvsfwldnvnmnnniltccydfgvkktisclstcv fpdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsviptn lfgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllwtmf nyqseepimlcvseedeksigqvaqtikdafnftgnmvfdtskadgqykktssnakflrl nptfqytpfeqaiketvqwflenyetark
>d6aqze_ c.2.1.0 (E:) automated matches {Naegleria fowleri [TaxId: 5763]} evsdqpitltqddvilvtggtglfgkavehivkkeqikgkwvflgskdgdlrdadackqp fekyrptyvihlaafvgglfknmnfkvsfwldnvnmnnniltccydfgvkktisclstcv fpdkieypiteeklhegpphfsnnayayakrmldmlgrwynekavnegksclftsviptn lfgphdnfnveaghvlpglmhkcykaqqngtdfvvfgsgkplrqflyshdaarmllwtmf nyqseepimlcvseedeksigqvaqtikdafnfttssnakflrlnptfqytpfeqaiket vqwflenyetark
Timeline for d6aqze_: