Lineage for d1cg2b1 (1cg2 B:26-213,B:327-414)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317273Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 317453Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 317538Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (4 proteins)
  6. 317555Protein Carboxypeptidase G2, catalytic domain [53208] (1 species)
  7. 317556Species Pseudomonas sp., strain rs-16 [TaxId:306] [53209] (1 PDB entry)
  8. 317558Domain d1cg2b1: 1cg2 B:26-213,B:327-414 [33845]
    Other proteins in same PDB: d1cg2a2, d1cg2b2, d1cg2c2, d1cg2d2

Details for d1cg2b1

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2

SCOP Domain Sequences for d1cg2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2b1 c.56.5.4 (B:26-213,B:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16}
qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
deklslgtXfnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpviesl
glpgfgyhsdkaeyvdisaiprrlymaarlimdlgag

SCOP Domain Coordinates for d1cg2b1:

Click to download the PDB-style file with coordinates for d1cg2b1.
(The format of our PDB-style files is described here.)

Timeline for d1cg2b1: