Lineage for d1cg2a1 (1cg2 A:26-213,A:327-414)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. Protein Carboxypeptidase G2, catalytic domain [53208] (1 species)
  7. Species Pseudomonas sp., strain rs-16 [TaxId:306] [53209] (1 PDB entry)
  8. Domain d1cg2a1: 1cg2 A:26-213,A:327-414 [33844]
    Other proteins in same PDB: d1cg2a2, d1cg2b2, d1cg2c2, d1cg2d2
    complexed with zn

Details for d1cg2a1

PDB Entry: 1cg2 (more details), 2.5 Å

PDB Description: carboxypeptidase g2
PDB Compounds: (A:) carboxypeptidase g2

SCOPe Domain Sequences for d1cg2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg2a1 c.56.5.4 (A:26-213,A:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16 [TaxId: 306]}
qkrdnvlfqaatdeqpaviktleklvnietgtgdaegiaaagnfleaelknlgftvtrsk
saglvvgdnivgkikgrggknlllmshmdtvylkgilakapfrvegdkaygpgiaddkgg
navilhtlkllkeygvrdygtitvlfntdeekgsfgsrdliqeeakladyvlsfeptsag
deklslgtXfnageggkklvdkavayykeaggtlgveertgggtdaayaalsgkpviesl
glpgfgyhsdkaeyvdisaiprrlymaarlimdlgag

SCOPe Domain Coordinates for d1cg2a1 are not available.

Timeline for d1cg2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cg2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1cg2b1, d1cg2b2, d1cg2c1, d1cg2c2, d1cg2d1, d1cg2d2