SCOPe 2.08: Domain d6aqhd1: 6aqh D:10-156

Lineage for d6aqhd1 (6aqh D:10-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [338433] (1 PDB entry)

8. Domain d6aqhd1: 6aqh D:10-156 [338438]
   Other proteins in same PDB: d6aqha2, d6aqhb2, d6aqhc2, d6aqhd2
   automated match to d3bjua1
   protein/RNA complex; complexed with edo, krs, lys

Details for d6aqhd1

PDB Entry: 6aqh, 2.35 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium thermoresistibile complexed with l-lysine and cladosporin

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6aqhd1:

Sequence; same for both SEQRES and ATOM records:

>d6aqhd1 b.40.4.0 (D:10-156) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
dlpeqfrirqakradllaqgrqpypvdvprthtlleirqaypdlpvdartgeivgvtgrv
vfarnsgklcfatlqegdgtqlqamislaevgqealdnwktyvdigdivfvhgevitskr
gelsvladswqmaakalrplpvahkem

Timeline for d6aqhd1:

• d6aqhd1 first appeared in SCOPe 2.06
  
• d6aqhd1 appears in SCOPe 2.07