Lineage for d1xjo__ (1xjo -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398477Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)
  6. 398482Protein Aminopeptidase [53205] (2 species)
  7. 398490Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 398494Domain d1xjo__: 1xjo - [33843]
    complexed with ca, mho, po4, zn

Details for d1xjo__

PDB Entry: 1xjo (more details), 1.75 Å

PDB Description: structure of aminopeptidase

SCOP Domain Sequences for d1xjo__:

Sequence, based on SEQRES records: (download)

>d1xjo__ c.56.5.4 (-) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Sequence, based on observed residues (ATOM records): (download)

>d1xjo__ c.56.5.4 (-) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteirsdhapfknvgvpvgglftgagytksaaqaqkwggtagqafdrcy
hsscdslsnindtaldrnsdaaahaiwtlss

SCOP Domain Coordinates for d1xjo__:

Click to download the PDB-style file with coordinates for d1xjo__.
(The format of our PDB-style files is described here.)

Timeline for d1xjo__: