Lineage for d1xjo__ (1xjo -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72401Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 72453Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins)
  6. 72454Protein Aminopeptidase [53205] (2 species)
  7. 72460Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 72464Domain d1xjo__: 1xjo - [33843]

Details for d1xjo__

PDB Entry: 1xjo (more details), 1.75 Å

PDB Description: structure of aminopeptidase

SCOP Domain Sequences for d1xjo__:

Sequence, based on SEQRES records: (download)

>d1xjo__ c.56.5.4 (-) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdxigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Sequence, based on observed residues (ATOM records): (download)

>d1xjo__ c.56.5.4 (-) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdigspnpgyfvydddpviekt
fknyfaglnvpteirsdhapfknvgvpvgglftgagytksaaqaqkwggtagqafdrcyh
sscdslsnindtaldrnsdaaahaiwtlss

SCOP Domain Coordinates for d1xjo__:

Click to download the PDB-style file with coordinates for d1xjo__.
(The format of our PDB-style files is described here.)

Timeline for d1xjo__: