Lineage for d1cp7a_ (1cp7 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317273Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 317453Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 317538Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (4 proteins)
  6. 317539Protein Aminopeptidase [53205] (2 species)
  7. 317546Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)
  8. 317548Domain d1cp7a_: 1cp7 A: [33842]
    complexed with ca, zn

Details for d1cp7a_

PDB Entry: 1cp7 (more details), 1.58 Å

PDB Description: aminopeptidase from streptomyces griseus

SCOP Domain Sequences for d1cp7a_:

Sequence, based on SEQRES records: (download)

>d1cp7a_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Sequence, based on observed residues (ATOM records): (download)

>d1cp7a_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietersdhapfknvgvpvgglftgagytksaaqaqkwggtagqafd
rcyhsscdslsnindtaldrnsdaaahaiwtlss

SCOP Domain Coordinates for d1cp7a_:

Click to download the PDB-style file with coordinates for d1cp7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cp7a_: