SCOPe 2.05: Domain d1qq9a_: 1qq9 A:

Lineage for d1qq9a_ (1qq9 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Streptomyces griseus [TaxId:1911] [53207] (5 PDB entries)

8. Domain d1qq9a_: 1qq9 A: [33841]
   complexed with ca, met, zn

Details for d1qq9a_

PDB Entry: 1qq9, 1.53 Å

PDB Description: streptomyces griseus aminopeptidase complexed with methionine

PDB Compounds: (A:) aminopeptidase

SCOPe Domain Sequences for d1qq9a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq9a_ c.56.5.4 (A:) Aminopeptidase {Streptomyces griseus [TaxId: 1911]}
apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
afdrcyhsscdslsnindtaldrnsdaaahaiwtlss

Timeline for d1qq9a_:

• d1qq9a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qq9a_ appears in SCOPe 2.04
  
• d1qq9a_ appears in SCOPe 2.06
  
• d1qq9a_ appears in the current release, SCOPe 2.08