Lineage for d1ft7a_ (1ft7 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838193Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 838204Protein Aminopeptidase [53205] (2 species)
  7. 838205Species Aeromonas proteolytica [TaxId:671] [53206] (13 PDB entries)
    Uniprot Q01693
    synonym: Vibrio proteolyticus
  8. 838216Domain d1ft7a_: 1ft7 A: [33840]
    complexed with k, plu, zn

Details for d1ft7a_

PDB Entry: 1ft7 (more details), 2.2 Å

PDB Description: aap complexed with l-leucinephosphonic acid
PDB Compounds: (A:) Bacterial leucyl aminopeptidase

SCOP Domain Sequences for d1ft7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft7a_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1ft7a_:

Click to download the PDB-style file with coordinates for d1ft7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft7a_: