Lineage for d1ft7a_ (1ft7 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398073Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 398389Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 398477Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)
  6. 398482Protein Aminopeptidase [53205] (2 species)
  7. 398483Species Aeromonas proteolytica [TaxId:671] [53206] (6 PDB entries)
    synonym: Vibrio proteolyticus
  8. 398489Domain d1ft7a_: 1ft7 A: [33840]
    complexed with k, plu, zn

Details for d1ft7a_

PDB Entry: 1ft7 (more details), 2.2 Å

PDB Description: aap complexed with l-leucinephosphonic acid

SCOP Domain Sequences for d1ft7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft7a_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1ft7a_:

Click to download the PDB-style file with coordinates for d1ft7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft7a_: