Lineage for d1igb__ (1igb -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25553Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 25605Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins)
  6. 25606Protein Aminopeptidase [53205] (2 species)
  7. 25607Species Aeromonas proteolytica [TaxId:671] [53206] (4 PDB entries)
  8. 25610Domain d1igb__: 1igb - [33839]

Details for d1igb__

PDB Entry: 1igb (more details), 2.3 Å

PDB Description: aeromonas proteolytica aminopeptidase complexed with the inhibitor para-iodo-d-phenylalanine hydroxamate

SCOP Domain Sequences for d1igb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igb__ c.56.5.4 (-) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1igb__:

Click to download the PDB-style file with coordinates for d1igb__.
(The format of our PDB-style files is described here.)

Timeline for d1igb__: