SCOPe 2.08: Domain d5vw2a1: 5vw2 A:8-156

Lineage for d5vw2a1 (5vw2 A:8-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226539] (17 PDB entries)

8. Domain d5vw2a1: 5vw2 A:8-156 [338387]
   Other proteins in same PDB: d5vw2a2
   automated match to d3lvba1
   complexed with act, fda, mg, nap; mutant

Details for d5vw2a1

PDB Entry: 5vw2, 1.45 Å

PDB Description: nadph soak of y316s mutant of corn root ferredoxin:nadp+ reductase

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5vw2a1:

Sequence; same for both SEQRES and ATOM records:

>d5vw2a1 b.43.4.0 (A:8-156) automated matches {Maize (Zea mays) [TaxId: 4577]}
skvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvpyw
egqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgked
pskngvcsnflcnskpgdkiqltgpsgki

Timeline for d5vw2a1:

• d5vw2a1 first appeared in SCOPe 2.06
  
• d5vw2a1 appears in SCOPe 2.07