Lineage for d1cp6a_ (1cp6 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) 
Family c.56.5.4: Bacterial exopeptidases [53204] (2 proteins) Protein Aminopeptidase [53205] (2 species) 
Species Aeromonas proteolytica [TaxId:671] [53206] (4 PDB entries) 
Domain d1cp6a_: 1cp6 A: [33838]
Details for d1cp6a_
PDB Entry: 1cp6 (more details), 1.9 Å
PDB Description: 1-butaneboronic acid binding to aeromonas proteolytica aminopeptidase
SCOP Domain Sequences for d1cp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cp6a_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
SCOP Domain Coordinates for d1cp6a_:
Click to download the PDB-style file with coordinates for d1cp6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cp6a_:
- d1cp6a_ appears in SCOP 1.57
- d1cp6a_ appears in the current release, SCOPe 2.08
View in 3D