Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries) |
Domain d5v9la1: 5v9l A:1-168 [338378] Other proteins in same PDB: d5v9la2, d5v9lb2, d5v9lc2 automated match to d4obea_ complexed with 91d, gdp, mg |
PDB Entry: 5v9l (more details), 1.98 Å
SCOPe Domain Sequences for d5v9la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v9la1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
Timeline for d5v9la1:
View in 3D Domains from other chains: (mouse over for more information) d5v9lb1, d5v9lb2, d5v9lc1, d5v9lc2 |